PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00026612-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family MYB_related
Protein Properties Length: 381aa    MW: 41224.4 Da    PI: 8.8425
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00026612-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.94.8e-13158202347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +WT+eE+  ++ + ++lG+g+W+ I+r +  +Rt+ q+ s+ qky
  PSME_00026612-RA 158 PWTEEEHRMFLIGLQKLGKGDWRGISRNFVPTRTPTQVASHAQKY 202
                       8*****************************9*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.60.103.0E-55680IPR001878Zinc finger, CCHC-type
PROSITE profilePS501589.1756279IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129419.478151207IPR017930Myb domain
SuperFamilySSF466894.71E-18153208IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-17154206IPR006447Myb domain, plants
SMARTSM007174.5E-10155205IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-12155201IPR009057Homeodomain-like
PfamPF002491.4E-10158202IPR001005SANT/Myb domain
CDDcd001671.56E-9158203No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
VCICITRLGI DLLFGSAFGF GFSRSNALSW DRIGFWLVFF VCLWAFNLGK NLYNSKACNM  60
TRKCSHCGHN GHNSRTCPNR GVKLFGVRLT DGPIRKSASM GNLLHYSNNA SSSNNSPGSA  120
SAMEPCESVA NAGAAADGYV SDGLVHNNSR GERKKGVPWT EEEHRMFLIG LQKLGKGDWR  180
GISRNFVPTR TPTQVASHAQ KYFIRQSNLT RRKRRSSLFD ITAEPVSCPL PSPALPVLSS  240
QSASDQEEAE SGDNSANSAD VDTLVPQVDE TASADMALFP GFATPYVPYG FPVWPTFRPT  300
LPQNSNVYKP TAVMPTAPIK IDECTGLSQL SLGDAPASAM KPSELSLRLH GRPSRQSAFQ  360
ANPSLNENNS LSSSSNVISV V
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF6784590.0EF678459.1 Picea sitchensis clone WS02922_K22 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012070032.11e-103PREDICTED: transcription factor MYB1R1
TrEMBLB8LRD40.0B8LRD4_PICSI; Putative uncharacterized protein
STRINGPGSC0003DMT4000674891e-100(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.11e-71MYB_related family protein